Sale!

wetakeprideintakingcareofeverycustomerweserveasiftheywerefamilywelovehelpingpeoplefindtheironvegansproutedproteindoublechocolate500gtheorganicgrocer0.png

Iron Vegan Sprouted Protein (Double Chocolate) 500g The Organic Grocer

Original price was: $ 38,65.Current price is: $ 23,19.

SKU: mode_6140679159976 Category: Proteins & Meal Replacements Tag: Brand_Iron Vegan

Description
shopping

Iron Vegan Sprouted Protein
Gone is the gritty, grainy mouth feel of a typical vegan protein. In its place is a smooth, delicious flavour and creamy texture that will almost certainly surprise you.

It begins with organic sprouted whole grain brown rice. Unlike white rice, the protein from brown rice is enzymatically extracted, without the use of chemical solvents, from multiple layers of whole grain including the bran, germ and endosperm.

Next is the addition of raw organic sprouted quinoa, amaranth, millet and pumpkin seed. Each of these organic sprouts is germinated at room temperature, allowing them to retain nutrients that would otherwise be compromised during cooking.

Last but not least is a combination of organic flavours and sweeteners that help to give Sprouted Protein its remarkable taste.

Benefits:

contains 17 grams of raw, plant-based protein
5 types of non-GMO sprouted grains and seeds
Provides a complete profile of all 9 essential and non-essential amino acids.
No artificial flavours or colours
Sweetened with organic stevia leaf
Remarkably smooth and creamy taste
Directions: Mix one scoop, 24 g, with 200ml of rice or almond milk, or the beverage of your choice. It can also be added to oatmeal, muffins or pancakes to help increase their protein content.

Prompt Delivery and professional packaging

We provide a variety of shipping options thanks to our long-standing partnerships with UPS, FedEx and DHL. Our warehouse staff is highly trained to package your goods exactly according to the specifications we provide. Your items are carefully inspected and properly secured before shipping. We ship to thousands clients each day across multiple countries. This is a sign of our determination to be the largest online retailer on earth. Warehouses and distribution centers can be located in Europe as well as in the USA.

Note: Orders with multiple items will have a distinct processing period for each item.

We will thoroughly inspect all items before sending. The majority of orders will be shipped within 48 hours. Delivery is expected to take between three and seven days.

Returns

The inventory is always changing and we are unable to control it completely because several parties are involved, including our factory and warehouse. Stocks can be changed at any moment. It is possible that stock may run out after your order has been placed.

The policy is for 30 days. If 30 days have gone without a trace since the purchase, unfortunately we can't offer an exchange or refund.

The item should not be used, and it must be in its original condition. It should also be returned in its original packaging.

Sale!

Iron Vegan Sprouted Protein (Double Chocolate) 500g The Organic Grocer

Related products

Login